"context" : "", { ] "includeRepliesModerationState" : "false", } }, LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "useTruncatedSubject" : "true", // enable redirect to login page when "logmein" is typed into the void =) }, "context" : "envParam:feedbackData", { }, ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "useSubjectIcons" : "true", } "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } "action" : "rerender" "event" : "ProductAnswerComment", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); } ] LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,message,product,contextId,contextUrl", { Wir haben die Lösung! "actions" : [ hallo, hab die karte in ein Amazone firephone gesteckt, ohne erfolg leider Geschwindigkeit ist unerträglich langsam. "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); "context" : "", "disableKudosForAnonUser" : "false", ] "event" : "AcceptSolutionAction", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "useTruncatedSubject" : "true", { "event" : "MessagesWidgetAnswerForm", element.siblings('li').removeClass('active'); } } "actions" : [ "action" : "rerender" }, // If watching, pay attention to key presses, looking for right sequence. } { })(LITHIUM.jQuery); "actions" : [ { "quiltName" : "ForumMessage", "context" : "envParam:quiltName,product,contextId,contextUrl", ] ], /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } "context" : "", } ] "initiatorBinding" : true, }, "initiatorBinding" : true, { $(document).ready(function(){ { { "action" : "rerender" "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101011101" }); ], "context" : "lia-deleted-state", ] // --> ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "event" : "kudoEntity", "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/70419","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-pRTdKrwp7SbjRAnExUomFUQD2IDsQ_z4OT8xJYyHXk. } }); "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":2447,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXBVYMAlJbAlcMAhgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVSVgNQBFEFXxQGAFEASQFXUAVIV18BVE8HU11TUgUDU1dWCABAThUPVn1bVgB\/AhsIQDFDC1BBQVwCRQtcXgYXWQNQXXldB18KX0cMCXswcBEYEA5VNFxBFjQFNUBWRktHDERqdy4ndDAVWlASI2QpdBIPB0QXVFRRQUVhLnxgJ0JDC0VaVxwMUlsGEi4rei1hEwsQGEs="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "forceSearchRequestParameterForBlurbBuilder" : "false", }, "action" : "rerender" "}); ] "actions" : [ "actions" : [ }, $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); "context" : "", LITHIUM.Dialog({ $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); } }); } { { }, "useTruncatedSubject" : "true", watching = false; }); "useTruncatedSubject" : "true", }, { "actions" : [ } "disableKudosForAnonUser" : "false", } ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); // If watching, pay attention to key presses, looking for right sequence. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ], "action" : "rerender" "action" : "rerender" "useTruncatedSubject" : "true", ] } } "actions" : [ { "disallowZeroCount" : "false", { "context" : "", ', 'ajax'); "context" : "envParam:feedbackData", "kudosLinksDisabled" : "false", { "action" : "pulsate" vor 10 Monaten 17 Dezember 2019. { "context" : "", } "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "removeThreadUserEmailSubscription", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "disallowZeroCount" : "false", { "event" : "editProductMessage", }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/70419","ajaxErrorEventName":"LITHIUM:ajaxError","token":"_lssCqguHXGiG00qOrx98O0ez3eslX7np6DcwAqukAY. { var handleOpen = function(event) { LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); } ] { "context" : "", "context" : "envParam:quiltName,message", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] "displayStyle" : "horizontal", "event" : "MessagesWidgetCommentForm", { }(LITHIUM.jQuery)); "context" : "", }, { }, ] "showCountOnly" : "false", ] { { }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, { }, { "action" : "pulsate" ] "useSimpleView" : "false", ] }, ] { ] }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); "context" : "lia-deleted-state", "event" : "kudoEntity", "context" : "", { "actions" : [ "eventActions" : [ "actions" : [ "actions" : [ "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/70419","ajaxErrorEventName":"LITHIUM:ajaxError","token":"GJO9-RuEJVBtcPzB13A2DZQuXLljSZ879kLypYWoBME. "kudosable" : "true", "event" : "removeMessageUserEmailSubscription", "includeRepliesModerationState" : "false", "disableLabelLinks" : "false", "action" : "pulsate" "context" : "envParam:quiltName,message", "messageViewOptions" : "1111110111111111111110111110100101011101" { { "action" : "rerender" "context" : "", "context" : "lia-deleted-state", } }, { { "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { } else { "event" : "unapproveMessage", })(LITHIUM.jQuery); { ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { { "context" : "", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); }, { "action" : "pulsate" { "context" : "", "truncateBodyRetainsHtml" : "false", "action" : "rerender" { "includeRepliesModerationState" : "false", "event" : "kudoEntity", "context" : "", count = 0; { ] { if ( watching ) { { "componentId" : "kudos.widget.button", { "context" : "", ], "context" : "", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "displaySubject" : "true", "useTruncatedSubject" : "true", "action" : "rerender" }, { "initiatorBinding" : true, "action" : "rerender" } }, ] "actions" : [ ], "selector" : "#kudosButtonV2_5", { } { $(document).ready(function(){ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2048176,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten.